PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010502.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 143aa    MW: 15586.8 Da    PI: 10.4102
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010502.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.73.7e-192761135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C+ C+tt Tp+WR gp g+++LCnaCG++yrkk++
  Do010502.1 27 CVECRTTATPMWRGGPTGPRSLCNACGIRYRKKRR 61
                ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-132171IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.33E-132362No hitNo description
Gene3DG3DSA:3.30.50.108.8E-152662IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.75E-112762No hitNo description
PROSITE profilePS5011412.1762757IPR000679Zinc finger, GATA-type
PfamPF003205.2E-172761IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402752IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MMDSAEQKVI GIAAAAAAAA EGGRPCCVEC RTTATPMWRG GPTGPRSLCN ACGIRYRKKR  60
RQELGLDNHT KPQQNHQQQQ PQPPLQPQQQ QHQDHSQAPS AVKDNKSSNL QVVKKRRVLM  120
GVEEAAILLM ALSSSSRSTL LHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280121e-59KJ728012.1 Zea mays clone pUT6147 C2C2-GATA transcription factor (GATA12) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977074.13e-60PREDICTED: GATA transcription factor 23-like
TrEMBLK3YAM73e-60K3YAM7_SETIT; Uncharacterized protein
STRINGSi011269m8e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.11e-20GATA transcription factor 23